DPCfam | MC66897
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 477 ± 57 aa |
| Residues in low-complexity regions (%) | 3.34 |
| Residues in coiled-coil regions (%) | 0.08 |
| Predicted disordered residues (%) | 22.82 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06466- PF00583 |
| Sequences matching dominant architecture (%) | 90.91 |
| Average overlap percent | 91.04 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A146KV88 | 73-551 | 479 | KTATLATVSDPCQTCGHLLSLHISHLNGLPDEELNRLLGMVVDTENIFNRFHREQDVEVKHIYYNLFRLLKTSIVQLKKPQIEQS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R4IXF6-F1 | 78-578 | 100.00 | 79.63 | View in AlphaFoldDB ↗ |