DPCfam | MC66771
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 73 ± 9 aa |
| Residues in low-complexity regions (%) | 2.21 |
| Residues in coiled-coil regions (%) | 44.17 |
| Predicted disordered residues (%) | 21.06 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q940K0 | 1-67 | 67 | MGSCFSLQVSDQTLNRIFNCLIGKSYIRTLEKNLRALQREMEDLRAIQHEVQNKVARDEARHQRRLE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9LMP6-F1 | 1-78 | 100.00 | 73.96 | View in AlphaFoldDB ↗ |