DPCfam | MC66638
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 86 ± 6 aa |
| Residues in low-complexity regions (%) | 1.38 |
| Residues in coiled-coil regions (%) | 0.32 |
| Predicted disordered residues (%) | 21.36 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02744 |
| Sequences matching dominant architecture (%) | 87.34 |
| Average overlap percent | 10.16 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000994E5F6 | 413-493 | 81 | LIEAMGLAILPPRLKGEFAVIRQYLLGYTKSVDPIHQEWAQRVKQTYGVFLNEAEANTVIQKETAKLFIKGLTDAGVFKNE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q1WUZ2-F1 | 407-489 | 98.86 | 96.97 | View in AlphaFoldDB ↗ |