DPCfam | MC6655
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 68 ± 11 aa |
| Residues in low-complexity regions (%) | 4.41 |
| Residues in coiled-coil regions (%) | 1.82 |
| Predicted disordered residues (%) | 15.84 |
| Average transmembrane regions | 1.0 |
| Dominant Pfam architecture(s) | PF15706 |
| Sequences matching dominant architecture (%) | 95.56 |
| Average overlap percent | 78.83 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| I3KJT6 | 945-1005 | 61 | TRGLSDLEIGMYALLGVFCLAILVFLINCVSFAFRYRHKQVPVLEAGGNMNHAHDWVWLGT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A2R8QMC8-F1 | 465-524 | 94.20 | 68.21 | View in AlphaFoldDB ↗ |