DPCfam | MC66354
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 231 |
|---|---|
| Mean domain length (aa) | 51 ± 5 aa |
| Residues in low-complexity regions (%) | 0.38 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.18 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF17132 |
| Sequences matching dominant architecture (%) | 99.47 |
| Average overlap percent | 13.01 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B8H6G5 | 15-74 | 60 | ALFPGFADPPVTARPRVWWHWMDGNIDPAGIVKDLEWLSSSGAGGVQAFTGSMGIPQYTR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-T2KNA8-F1 | 30-80 | 98.08 | 97.65 | View in AlphaFoldDB ↗ |