DPCfam | MC6628
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 82 ± 6 aa |
| Residues in low-complexity regions (%) | 4.39 |
| Residues in coiled-coil regions (%) | 0.34 |
| Predicted disordered residues (%) | 35.98 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1H0IDG1 | 1-90 | 90 | MAITLPFGVRVAVGVLGAAVDRLVTLPRELPAIGVSLAGQAVRTSLRVQQELAELATRGDELLSGITGRPEEHPAWATFDDEEEA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P9WM58-F1 | 5-83 | 97.53 | 72.82 | View in AlphaFoldDB ↗ |