DPCfam | MC66176
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 303 ± 30 aa |
| Residues in low-complexity regions (%) | 2.2 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.07 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13649 |
| Sequences matching dominant architecture (%) | 4.26 |
| Average overlap percent | 22.85 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G8XGI7 | 207-473 | 267 | SYLPMLARLGDLLGGAADDPARYVDRALNSRARHAAHERYDKDLLTVVLDLFNRPCPEEQPRFVAEVGCGDGGRLSAIHRAIRDR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1JKQ0-F1 | 42-110 | 24.68 | 95.05 | View in AlphaFoldDB ↗ |