DPCfam | MC65835
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 551 |
|---|---|
| Mean domain length (aa) | 378 ± 50 aa |
| Residues in low-complexity regions (%) | 5.77 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 28.41 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF13203- PF09967 |
| Sequences matching dominant architecture (%) | 77.73 |
| Average overlap percent | 94.35 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0Q9IV08 | 29-404 | 376 | FPHLAGLAAAVRVEIDERVPTMGVFASGRLLANPAFTARLSGDDLVFVLAHELLHLALRTHDRARGSATLEFNYAHDYIINDMLR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0EXS0-F1 | 22-374 | 98.08 | 83.76 | View in AlphaFoldDB ↗ |