DPCfam | MC65641
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 112 ± 14 aa |
| Residues in low-complexity regions (%) | 4.1 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 2.32 |
| Average transmembrane regions | 3.2 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0A9SVL2 | 3-107 | 105 | VGDHGTAALAISLPFACVLGLFSSLTTTKMVSRRYVWIYSAVQFLFIVLFTHLFYRYMRMQAVIAIIMPTFAAFSVTICANSLLL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0HE50-F1 | 325-441 | 99.15 | 92.01 | View in AlphaFoldDB ↗ |