DPCfam | MC65597
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 57 ± 5 aa |
| Residues in low-complexity regions (%) | 1.5 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 32.36 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00562 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 27.19 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W1PAN8 | 430-489 | 60 | GGCLKGSFVDATPFASSTSQTNAESQSKSGTPIEEFGPVLASYGFNYHGTEVLYSGVLGT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1D6KRW8-F1 | 917-982 | 98.39 | 85.58 | View in AlphaFoldDB ↗ |