DPCfam | MC6556
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 290 ± 34 aa |
| Residues in low-complexity regions (%) | 1.34 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.5 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03537 |
| Sequences matching dominant architecture (%) | 70.91 |
| Average overlap percent | 40.36 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1E5Q9C7 | 30-337 | 308 | IIDFRETMRALVQNISAYARSLKPGFIVIAEHGLDLVTKPDFQDNTLLFPARTFARSLDGVLEPELFPRLTPPSGKEAAKEAPAL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q58872-F1 | 43-199 | 53.36 | 87.96 | View in AlphaFoldDB ↗ |