DPCfam | MC65515
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 251 |
|---|---|
| Mean domain length (aa) | 136 ± 23 aa |
| Residues in low-complexity regions (%) | 0.72 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 28.44 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01833 |
| Sequences matching dominant architecture (%) | 49.73 |
| Average overlap percent | 31.88 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A158R541 | 941-1060 | 120 | CAIQNSTSMFCRTPKADIPYDHLSGTYSRWPVGFLMDNVESVRNYGYSNLQITVVPDPVFAPFDGVRMHKPGQPFIVEGNHLSHA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A077Z670-F1 | 1077-1230 | 94.41 | 68.07 | View in AlphaFoldDB ↗ |