DPCfam | MC65487
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 305 ± 21 aa |
| Residues in low-complexity regions (%) | 4.09 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.1 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF16589 |
| Sequences matching dominant architecture (%) | 57.14 |
| Average overlap percent | 26.77 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00070463C7 | 1-342 | 342 | MTVAIFANCVFFLKVKHLPIQEKNRLRTCIKENGGLIYFMLNHECTHVIVDNVASLSSYHLKTIQKHQLPIVSADFIWKSAEEGK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A2R8RUY6-F1 | 1-317 | 99.35 | 74.13 | View in AlphaFoldDB ↗ |