DPCfam | MC65400
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 331 |
|---|---|
| Mean domain length (aa) | 184 ± 14 aa |
| Residues in low-complexity regions (%) | 5.3 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.59 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF05845 |
| Sequences matching dominant architecture (%) | 99.6 |
| Average overlap percent | 98.21 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0C7CTY1 | 18-203 | 186 | PAFQDPVLDAQRSFRAALKALAEPGLVRNLDRAPALAALQPASYALCLSFLDSDTPLWLAPGLDSPTLRANLAFHCGCPIVAERE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P16686-F1 | 10-192 | 100.00 | 97.24 | View in AlphaFoldDB ↗ |