DPCfam | MC65284
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 170 ± 8 aa |
| Residues in low-complexity regions (%) | 1.12 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.29 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08864- PF08858 |
| Sequences matching dominant architecture (%) | 74.36 |
| Average overlap percent | 95.59 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009885A3F | 4-177 | 174 | TVSISEKRAFLKWFLRRFELKSRECVWLLNYILSVDHTVNLLRFVDNVVDCPRAMIVSEKHTPDPPFIYRVRNVVTEQPEKAFHD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A7Z610-F1 | 5-178 | 100.00 | 87.10 | View in AlphaFoldDB ↗ |