DPCfam | MC65118
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 451 |
|---|---|
| Mean domain length (aa) | 66 ± 10 aa |
| Residues in low-complexity regions (%) | 2.09 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 6.35 |
| Average transmembrane regions | 0.29 |
| Dominant Pfam architecture(s) | PF04082 |
| Sequences matching dominant architecture (%) | 90.89 |
| Average overlap percent | 34.92 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| L7J735 | 502-573 | 72 | QLAETYFTVFHPHWPIIHRGTFMSNQQPELLTRAVMIIGLFFQGSAEARALAVQHHRKLLKEAQDKVVILSK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2GLS3-F1 | 403-471 | 94.52 | 93.13 | View in AlphaFoldDB ↗ |