DPCfam | MC65075
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 112 ± 14 aa |
| Residues in low-complexity regions (%) | 8.15 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 30.14 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF16640 |
| Sequences matching dominant architecture (%) | 2.44 |
| Average overlap percent | 54.55 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| K0EXF3 | 22-138 | 117 | VTNMHIEQGQSFGSSDALGTGCSYEVTITTEPGTTIGMLDQIGDDPRTADHKQFRPGKIVADASGTARTTWTPDRKGPHKLVALE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0F503-F1 | 14-126 | 97.46 | 87.79 | View in AlphaFoldDB ↗ |