DPCfam | MC64739
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 4331 |
|---|---|
| Mean domain length (aa) | 99 ± 12 aa |
| Residues in low-complexity regions (%) | 1.69 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.11 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03330 |
| Sequences matching dominant architecture (%) | 65.92 |
| Average overlap percent | 84.0 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C4WYD0 | 1-62 | 62 | MTAAHRTLPFNTMVKVETMGTNVVVKINDRKTAADGKVMLLSRAAAESLNIDENTGPVQCQL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1D6KX41-F1 | 446-564 | 94.67 | 87.77 | View in AlphaFoldDB ↗ |