DPCfam | MC64579
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 107 ± 9 aa |
| Residues in low-complexity regions (%) | 0.33 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 28.77 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15633 |
| Sequences matching dominant architecture (%) | 90.24 |
| Average overlap percent | 93.19 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009BB0584 | 1087-1189 | 103 | HYTSEEGYKAIMESGELLPSIGVKNARHGAGQYFTDLASNELTKGQVSRRLFGVPWNTKSITHFIEIDVRGLNVVKNAPNNFLIP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q57805-F1 | 8-45 | 37.74 | 96.44 | View in AlphaFoldDB ↗ |