DPCfam | MC64479
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 65 ± 8 aa |
| Residues in low-complexity regions (%) | 2.65 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 33.5 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00565 |
| Sequences matching dominant architecture (%) | 95.0 |
| Average overlap percent | 36.98 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q754Z2 | 204-273 | 70 | VEYWSWFRWKNVSIELLKQGLGVVYESKSGAEFDGQDTLYRYHESKAKKSKRGVWGLRHFETPGAYKKRI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B0D7T0-F1 | 202-280 | 98.44 | 82.39 | View in AlphaFoldDB ↗ |