DPCfam | MC6436
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 118 ± 8 aa |
| Residues in low-complexity regions (%) | 2.56 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.79 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13715 |
| Sequences matching dominant architecture (%) | 2.08 |
| Average overlap percent | 9.73 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1B9F9H1 | 562-671 | 110 | GEGNLIYPEPKIKVLNTGDITSAYISLNPWSFLGQRADLFIVANTPFGLYSYIYPNGPWVPGLVTAYTGDISQISETRILNHSIP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1M4J1-F1 | 735-774 | 34.75 | 91.67 | View in AlphaFoldDB ↗ |