DPCfam | MC64165
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 206 ± 26 aa |
| Residues in low-complexity regions (%) | 4.9 |
| Residues in coiled-coil regions (%) | 0.15 |
| Predicted disordered residues (%) | 18.05 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| T1JDY8 | 310-498 | 189 | DELREKCTEWIEKVKAKVREELSQVITFIKSINGLSIIRDTVADVINKKNENEKWNTVCGKLLRNDLQMWEDIFEPLFLNQMKSI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R4IXT6-F1 | 339-535 | 96.45 | 88.31 | View in AlphaFoldDB ↗ |