DPCfam | MC63947
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 401 |
|---|---|
| Mean domain length (aa) | 80 ± 6 aa |
| Residues in low-complexity regions (%) | 1.24 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.04 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF04055 |
| Sequences matching dominant architecture (%) | 74.93 |
| Average overlap percent | 7.55 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M8D857 | 243-324 | 82 | MLGLGETDEEVKQAMIDLRAVGVDILTLGQYLQPTEKHLTVREYVMPEKFQFWKEYGESLGFCYVASGPLVRSSYRAGELFV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A6GZL9-F1 | 209-287 | 97.53 | 96.55 | View in AlphaFoldDB ↗ |