DPCfam | MC63938
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 62 ± 9 aa |
| Residues in low-complexity regions (%) | 2.21 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 48.27 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF17226 |
| Sequences matching dominant architecture (%) | 14.63 |
| Average overlap percent | 48.03 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q13330 | 623-689 | 67 | LNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLLSSSETKRAARRPYKPIA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1QLG2-F1 | 574-638 | 98.46 | 55.66 | View in AlphaFoldDB ↗ |