DPCfam | MC63900
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 859 ± 50 aa |
| Residues in low-complexity regions (%) | 4.98 |
| Residues in coiled-coil regions (%) | 0.12 |
| Predicted disordered residues (%) | 22.88 |
| Average transmembrane regions | 0.13 |
| Dominant Pfam architecture(s) | PF08005- PF08005 |
| Sequences matching dominant architecture (%) | 92.86 |
| Average overlap percent | 75.89 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00077FDAAD | 1004-1896 | 893 | WSAIPGAVPNIGTKYGRRATWIGASGDLTFVKIDESLINSHNLSKSSVVCNKSCIGIIPNQIEQASSFRSLVISKSDGSCRSFSS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q965Y9-F1 | 848-1655 | 99.88 | 76.72 | View in AlphaFoldDB ↗ |