DPCfam | MC63890
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 109 ± 12 aa |
| Residues in low-complexity regions (%) | 3.14 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.29 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13191 |
| Sequences matching dominant architecture (%) | 44.58 |
| Average overlap percent | 34.44 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| S4XWV8 | 17-126 | 110 | LQELYNRCNPDEPLSPGDERNVDIDVRGVRGAHWTNKLARQIELSRTPVCQLFTGLRGTGKSTEIQRLAARLSDPKRRNLLTVLI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8PVG9-F1 | 323-365 | 38.18 | 93.10 | View in AlphaFoldDB ↗ |