DPCfam | MC63874
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 251 |
|---|---|
| Mean domain length (aa) | 72 ± 17 aa |
| Residues in low-complexity regions (%) | 0.93 |
| Residues in coiled-coil regions (%) | 0.17 |
| Predicted disordered residues (%) | 30.9 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00833 |
| Sequences matching dominant architecture (%) | 96.51 |
| Average overlap percent | 82.51 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0A7V0B5 | 4-63 | 60 | IKRISNELMNEYSERFGTDFVTNKQSLNEISIVRSKGLKNKIAGYITKILQRQAKFEERK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q90YQ6-F1 | 1-85 | 100.00 | 93.45 | View in AlphaFoldDB ↗ |