DPCfam | MC63829
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 371 |
|---|---|
| Mean domain length (aa) | 133 ± 13 aa |
| Residues in low-complexity regions (%) | 7.54 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 2.56 |
| Average transmembrane regions | 2.99 |
| Dominant Pfam architecture(s) | PF13787 |
| Sequences matching dominant architecture (%) | 99.63 |
| Average overlap percent | 82.42 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009D7233E | 15-152 | 138 | INVLLWLIPVLFTIHNLEEALTMRKYGTEHFKKMQRGQFPAAVTILTLLVVVFIYFGTREEVGLVGRFLAIFGQASLFINALAHI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P54438-F1 | 6-138 | 97.78 | 95.31 | View in AlphaFoldDB ↗ |