DPCfam | MC6362
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 77 ± 7 aa |
| Residues in low-complexity regions (%) | 2.38 |
| Residues in coiled-coil regions (%) | 9.28 |
| Predicted disordered residues (%) | 26.01 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03999 |
| Sequences matching dominant architecture (%) | 95.45 |
| Average overlap percent | 25.24 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1J3IAL6 | 1-68 | 68 | KVNSYVNAVHELSEIMSFDFSKALSNVHKSLTDSSKAHSKSISTDTLARLTELVESLKKEKHQRLLKL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R0G8J2-F1 | 184-264 | 98.78 | 93.48 | View in AlphaFoldDB ↗ |