DPCfam | MC63551
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 420 ± 40 aa |
| Residues in low-complexity regions (%) | 6.14 |
| Residues in coiled-coil regions (%) | 1.27 |
| Predicted disordered residues (%) | 30.53 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF09234 |
| Sequences matching dominant architecture (%) | 67.5 |
| Average overlap percent | 46.16 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| J2GLW5 | 177-580 | 404 | ILIRKPREPGRDWFSDASWLGGLPKLGDAPWPRDAGGVPVPFAAQIDLADLAFAAPGAALPTSGSLAFFLGSGAVIAVPDGEHGF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P96719-F1 | 27-115 | 19.81 | 96.82 | View in AlphaFoldDB ↗ |