DPCfam | MC63545
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 87 ± 10 aa |
| Residues in low-complexity regions (%) | 10.39 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 43.22 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08174 |
| Sequences matching dominant architecture (%) | 86.27 |
| Average overlap percent | 67.43 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0D1ZA60 | 1065-1153 | 89 | KKKKESEVRAQQEAQAVRRPVTPPSAYELVQGLVAKDGSFARAYISLSEHEKQAYGRPYNVDITCFNEWAMEEVHVGSSRSKKSV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175VU90-F1 | 1116-1205 | 94.68 | 82.73 | View in AlphaFoldDB ↗ |