DPCfam | MC63472
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 811 |
|---|---|
| Mean domain length (aa) | 251 ± 40 aa |
| Residues in low-complexity regions (%) | 7.47 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.85 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12840 |
| Sequences matching dominant architecture (%) | 65.62 |
| Average overlap percent | 19.39 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1Q4DTI6 | 72-313 | 242 | PDCLSPHDPAHDTDVRAEIGRLRDLSASELLGDLRETFDDRPPRQWEEIAAAPQRWAHDVADVLDALWAVVEPVWRREDALRGRE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0FAP8-F1 | 44-329 | 99.60 | 91.06 | View in AlphaFoldDB ↗ |