DPCfam | MC63403
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 92 ± 9 aa |
| Residues in low-complexity regions (%) | 0.8 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 4.46 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF18025 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 85.85 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0M8KF37 | 4-127 | 124 | IKIAFCGQWDNKVIQDEFVKLLSGRVKLEISDRPDFLVCGCFNNDFLKYGERPIRIYYYTENVFPDFNLFDYAIGFHNLKYGDRH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O30511-F1 | 25-124 | 98.91 | 87.12 | View in AlphaFoldDB ↗ |