DPCfam | MC63341
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 211 |
|---|---|
| Mean domain length (aa) | 58 ± 9 aa |
| Residues in low-complexity regions (%) | 12.06 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 79.98 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08492 |
| Sequences matching dominant architecture (%) | 96.39 |
| Average overlap percent | 39.79 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A183C5L8 | 35-101 | 67 | RLPANFDPQIPPDPERWLPRQERTAYRKKLHKKYKDRDIGRGTQGAAAGAAANIDYSNASSKPGSSG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F8VQC1-F1 | 556-612 | 94.92 | 58.45 | View in AlphaFoldDB ↗ |