DPCfam | MC63079
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 198 ± 20 aa |
| Residues in low-complexity regions (%) | 2.14 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.93 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF13199 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 33.92 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1M7XVY8 | 10-191 | 182 | CFPDKAQYLEGELVGILLEAENRENIIEVEFTVSELDRILFRKTVRTSELMAGAIAYKMSCELPVGNYGVDVKVIYADYTIQVHT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P94286-F1 | 44-239 | 98.48 | 97.14 | View in AlphaFoldDB ↗ |