DPCfam | MC62800
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 125 ± 23 aa |
| Residues in low-complexity regions (%) | 0.91 |
| Residues in coiled-coil regions (%) | 0.2 |
| Predicted disordered residues (%) | 25.56 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A158R2N5 | 72-211 | 139 | KQMDLKALMANWRMPARAKKDDHIIQCVDFVRFYLSRACDPVEEISRYAVRVSGKHAKGPTKADLPDGIVDTLIKCLLDGLRMGQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9U2B1-F1 | 199-313 | 84.17 | 87.62 | View in AlphaFoldDB ↗ |