DPCfam | MC62450
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 92 ± 10 aa |
| Residues in low-complexity regions (%) | 2.78 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.23 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15396 |
| Sequences matching dominant architecture (%) | 98.39 |
| Average overlap percent | 51.85 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C3Y7B8 | 111-208 | 98 | MFSFHKPKVYRSISGCCICGAKSSSSRFTDSAKYEVEFQKCFKLHEERSGEICNACVLLVKRWKKLPKGTDRNWHHVVDARAGPG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5ZJV7-F1 | 7-95 | 97.92 | 90.14 | View in AlphaFoldDB ↗ |