DPCfam | MC6218
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 3861 |
|---|---|
| Mean domain length (aa) | 260 ± 63 aa |
| Residues in low-complexity regions (%) | 8.0 |
| Residues in coiled-coil regions (%) | 0.03 |
| Predicted disordered residues (%) | 36.42 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF00226- PF01556 |
| Sequences matching dominant architecture (%) | 61.49 |
| Average overlap percent | 92.21 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M5W8P5 | 72-402 | 331 | ATLQEIKSSYRKLARKYHPDLNKGAGAEDKFKEISSAYEVLSDDEKRSLYDRFGEAGLQGEYDSSAMGSTGVDPFDVFDTFFGGS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B8CXL0-F1 | 22-335 | 100.00 | 86.07 | View in AlphaFoldDB ↗ |