DPCfam | MC62140
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 81 ± 4 aa |
| Residues in low-complexity regions (%) | 4.63 |
| Residues in coiled-coil regions (%) | 1.55 |
| Predicted disordered residues (%) | 6.13 |
| Average transmembrane regions | 0.16 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q5KI79 | 123-206 | 84 | DGVKGMIEVLKRVMQRYKYLQKPLEENFLPGVLSYLPKWDVKSREKLAEATALLTIELQISSRCLQSLAKEHVVKDNVALNFLT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6PD83-F1 | 104-185 | 98.80 | 96.70 | View in AlphaFoldDB ↗ |