DPCfam | MC61784
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 64 ± 10 aa |
| Residues in low-complexity regions (%) | 7.71 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 28.23 |
| Average transmembrane regions | 0.07 |
| Dominant Pfam architecture(s) | PF00702 |
| Sequences matching dominant architecture (%) | 2.0 |
| Average overlap percent | 5.68 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1D5AC07 | 1-72 | 72 | MALGISIKSPPRIVISAASMATSVPVPMAIPISALTNAGASFTPSPTIATFLPCCCSFAICAAFSSGKISAI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0P0VRU3-F1 | 2-57 | 86.15 | 56.51 | View in AlphaFoldDB ↗ |