DPCfam | MC61603
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 74 ± 6 aa |
| Residues in low-complexity regions (%) | 3.23 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.92 |
| Average transmembrane regions | 0.07 |
| Dominant Pfam architecture(s) | PF08424 |
| Sequences matching dominant architecture (%) | 86.96 |
| Average overlap percent | 27.68 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A9UTC3 | 545-611 | 67 | WLEVEQFRDLTHWKPWRPLPGQETEEDCEDPDRIVVYDDISSLLFRLSDPTLQVDMILHFVYQLGLS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q80XC6-F1 | 585-656 | 98.63 | 90.52 | View in AlphaFoldDB ↗ |