DPCfam | MC61587
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 100 ± 11 aa |
| Residues in low-complexity regions (%) | 14.03 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 53.08 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05383 |
| Sequences matching dominant architecture (%) | 1.44 |
| Average overlap percent | 28.09 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| V5HCB6 | 253-372 | 120 | ALDPDREELEFQFDEELERAPDGRKNTFTEWSDDSDYEFSDTEVNKILIVTQTPPAPAPAQGGAGAGAGLRKHEGYDRTGDWTTR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1M062-F1 | 434-529 | 98.00 | 57.04 | View in AlphaFoldDB ↗ |