DPCfam | MC61571
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 263 ± 43 aa |
| Residues in low-complexity regions (%) | 6.54 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 30.34 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF00612 |
| Sequences matching dominant architecture (%) | 15.0 |
| Average overlap percent | 5.68 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0005C370F1 | 182-437 | 256 | AASIIQRAWRRHIDIQVYRYYRDLINFKTRGNPALMLRCINPNEAKMLDAASGVHVKFRLAGERFPPNIYYKIFTHRPVQDLCAN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8NCR3-F1 | 14-255 | 100.00 | 80.73 | View in AlphaFoldDB ↗ |