DPCfam | MC61285
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 492 ± 49 aa |
| Residues in low-complexity regions (%) | 9.69 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 54.66 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00649 |
| Sequences matching dominant architecture (%) | 90.0 |
| Average overlap percent | 5.94 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0B1P9A6 | 1-530 | 530 | MPLINGMKMACEPCIRGHRSTKCNHANERLMVPVRKPGRPLSSCPHLKDHLCSCNSITAAIPRKQVCQCSISSSTKNTNVAARAT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C1GPS1-F1 | 1-510 | 99.80 | 49.57 | View in AlphaFoldDB ↗ |