DPCfam | MC61282
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 198 ± 35 aa |
| Residues in low-complexity regions (%) | 8.09 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 43.93 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF15256 |
| Sequences matching dominant architecture (%) | 91.84 |
| Average overlap percent | 88.39 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00094813CB | 70-308 | 239 | ASRPATSPGSRFGELSRSSFFSRHNPHPVRVRHIKGLNDIPICAVHDTGFVSSPRWNLSTPGTAQRERIFKHHMPVNAIGINSTK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q96M53-F1 | 69-271 | 99.52 | 68.90 | View in AlphaFoldDB ↗ |