DPCfam | MC61249
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 71 ± 11 aa |
| Residues in low-complexity regions (%) | 0.19 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 8.02 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF02098 |
| Sequences matching dominant architecture (%) | 87.6 |
| Average overlap percent | 42.78 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A131YSM7 | 113-207 | 95 | LTAINMYNYKMKNAIKFQTHGASVKTFNDALVYTDGEYCNIFYTTNGSSDGKQQGGYELWMAEKKVNQIPRLCELLFTALTEGMS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O77422-F1 | 123-194 | 95.65 | 96.20 | View in AlphaFoldDB ↗ |