DPCfam | MC61238
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 3311 |
|---|---|
| Mean domain length (aa) | 308 ± 58 aa |
| Residues in low-complexity regions (%) | 2.86 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.47 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF13183- PF02754- PF02754 |
| Sequences matching dominant architecture (%) | 31.07 |
| Average overlap percent | 86.53 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1F9LL90 | 53-428 | 376 | TYAPAYKADQIRKLFKRHVDWTGRYLPWWVKAGTVKSDEDLEQLKDTVFGKCTNCRRCSLNCPMGVDYASFNRMARGLLVSVGVM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6LYC4-F1 | 184-467 | 97.07 | 97.42 | View in AlphaFoldDB ↗ |