DPCfam | MC61235
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 2511 |
|---|---|
| Mean domain length (aa) | 91 ± 13 aa |
| Residues in low-complexity regions (%) | 1.14 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 11.13 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF02958 |
| Sequences matching dominant architecture (%) | 66.39 |
| Average overlap percent | 36.72 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M5A271 | 187-264 | 78 | LVHGDFRLGNIIVGSEGLRAVIDWELAHLGDPMEDLGWLCVKAWRFGGAPPVAGLGEYDELFDAYQAASGIEIDPDVV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A077Z471-F1 | 1468-1549 | 85.90 | 73.76 | View in AlphaFoldDB ↗ |