DPCfam | MC60736
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 483 ± 44 aa |
| Residues in low-complexity regions (%) | 2.39 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.03 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF09084- PF00691 |
| Sequences matching dominant architecture (%) | 32.43 |
| Average overlap percent | 86.4 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1F7W7A6 | 73-646 | 574 | INLGYILWGGELPLFWGMGGTQTRAGTIFAEHGLNFKLFAADNTAAQIAMYKRGETPFLRMTFTTISRYLAELCPTPNADLCPEK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6RYW5-F1 | 176-332 | 33.47 | 88.62 | View in AlphaFoldDB ↗ |