DPCfam | MC60686
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 178 ± 15 aa |
| Residues in low-complexity regions (%) | 2.03 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 5.94 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF02302 |
| Sequences matching dominant architecture (%) | 88.37 |
| Average overlap percent | 43.71 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A140DVT4 | 16-181 | 166 | QVRHLPGALFCETMQSIWFVSDGTCGFIRLWEGHIVEMEIPALGFWAHFDGDDAILFLDHIHAFFKALHRQDVRDNWLMQTSHPM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GYX7-F1 | 2-93 | 49.72 | 94.36 | View in AlphaFoldDB ↗ |